PepID and fusion tags:
PepID expression vectors can be equipped with various tags for protein purification, reporter analysis, specific localization, etc. The standard tag is GST (glutathion-S-transferase). Refer to the second box to see what tags can be offered.
Affinity and other tags:
Tag | Length | Amino Acid Sequence | size (kDa) |
Arg5-Tag | 5 (-6) | RRRRR | 0.8 |
His6-Tag (Hexa-His) | 6 (2-10) | HHHHHH | 0.8 |
Hat-Tag | 19 | KDHLIHNVHKEFHAHAHNK | 2.3 |
V5-Peptide-Tag | 14 | GKPIPNPLLGLDST | 1.4 |
Flag-Tag | 8-10 | DYKDDDDK | 1.0 |
3 x Flag-Tag | 22 | DYKDHDGDYKDHDIDYKDDDDK | 2.7 |
Strep-Tag I | 9 | AWRHPQFGG | 1.0 |
Strep-Tag II | 8 | WSHPQFEK | 1.1 |
Nano-Tag9 | 9 | MDVEAWLGAR | 1.15 |
Nano-Tag15 | 15 | MDVEAWLGARVPLVET | 1.8 |
SBP-Tag | 38 | MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP | 4.3 |
c-myc-Tag | 11 | EQKLISEEDL | 1.2 |
S-Tag | 15 | KETAAAKFERQHMDS | 1.75 |
Applications:
More to come soon...
More to come soon...